PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_21500V3.2.p
Common NamePHYPADRAFT_233852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2613aa    MW: 278090 Da    PI: 6.1604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_21500V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-0811691212347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                           WT  E el+ ++v+++G++ +++Ia ++g +++  qck ++ k 
  Pp3c12_21500V3.2.p 1169 QWTDRERELFTEGVRLFGKD-FERIAVHVGSTKSVGQCKAFFCKT 1212
                          5*****************99.*********99********99886 PP

2Myb_DNA-binding33.97.4e-1116941735346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                          +WT+eE e+++d ++ +G++ W++  ++++  ++l q+k ++q+
  Pp3c12_21500V3.2.p 1694 SWTQEEKEKFADIIRNHGKD-WTRLHECLP-SKSLTQIKTYFQN 1735
                          7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.9E-13906969IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-4915962IPR009057Homeodomain-like
PROSITE profilePS5129317.276918969IPR017884SANT domain
SMARTSM007172.1E-7919967IPR001005SANT/Myb domain
PROSITE profilePS5129317.61711651217IPR017884SANT domain
SMARTSM007171.1E-811661215IPR001005SANT/Myb domain
PfamPF002499.4E-711691211IPR001005SANT/Myb domain
SuperFamilySSF466892.54E-911691219IPR009057Homeodomain-like
CDDcd001671.52E-511701211No hitNo description
SuperFamilySSF466892.97E-1016891739IPR009057Homeodomain-like
PROSITE profilePS512938.54216901741IPR017884SANT domain
SMARTSM007177.1E-916911739IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-716921736IPR009057Homeodomain-like
PfamPF002493.4E-816941735IPR001005SANT/Myb domain
CDDcd001672.35E-616941737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 2613 aa     Download sequence    Send to blast
MYSPGRGDAR ATALPNARDS STSMPIDHAS AWHREPYNRD ARLDRGDRER IIGGKREWNS  60
DRASFGAPYP RAFGGLHPVN GSLGPPNKRR LNGRHTGFHN EGGRYVSPGH RGEPPFGSVG  120
PVENGLGRKF DRESFYPGSG CPVGGSGFGN GVGVDQRAKE LEERHKKEPF LLLRDGRDGG  180
SCGGIEHGVR SFPSQAVCEA EKSCWERERS KGAVGNGWES SQKLQRDLRE RVGGKAEGYS  240
RREGKLSQHD GGREWSQADK ELEGRRVDGY GSSSRDGLTG DGVGGIKEAV GGCEWRRKER  300
SSSVSASRSG SYVASSGTAK GPVGRPQALD VSGSASSPQV SPHSTASPGV QEASRDDGSQ  360
PSPPKRPRLG WGQGLAKYEK KKVVETDEVG VSASGGSVSG RERSSVSGAT TEVVQTQESQ  420
AAEESPVSVV SNLSTLPPLT PSASPSQQAA EVVSKAMVEC DGVEQEVVGK VCERVAAEAE  480
AGGWISKPEG VVADDVEKRG NMRAVTECGL EESVRQGECC EALGLKESME CQASPKVRGS  540
VEHCGGVEVG GEVGVSDAGS RWAKEDILLR VEKVEYEIEE VERELAKAEK VGSDRRAAGE  600
WVAGVVGDEG SAGVDGVVKV EDGIDDGEAM DVDAAEVHPG RVDSRESGEA MQVACSGRNW  660
SGGEECGNGR WGSDGAGAAG NVGERVGGGV SEGGHGGSVD DGGVLEEEKE EAERKVISWD  720
VEVVARSLME ENKKRAEQAR ETFVHLLREG VGVEGTLYRC PAEAGVWKEN VERHYRNQER  780
MLEKMGERRQ SLRFAEQVLA MRFRALKEAW KQEQVGMRQQ QRGTKPVRRW EVEKRNGTAL  840
HCHRSSLRLR PVQAGMEKVE AVSEECMKKV MAKAVVGPVR GVLKMPSMIV GQENRLARRF  900
ESKNALVEDP VGMERERKSM NPWSWEEKRV FLEKFAVYNK NFSKIASHLE LKTTADCVEF  960
YYRNQKSEDF ERIRRRQQLK KRRDYSRVGG SFLSTGLQTS SQRREANGHG RTEGANVQTV  1020
GAVVGVSHIS VGTKAARSSM QQKPVERQRV SSALEPGSLP GAVEIGKGVS GKENKWCGTG  1080
GVSGSAAGRG GIFGMVLSGA TVSCGLSSAV AGAVKIGRER SSVKTMVDAG LVVARCGQYE  1140
PNCFGAKGTR SIHPPLGLEN FAKEEGDAQW TDRERELFTE GVRLFGKDFE RIAVHVGSTK  1200
SVGQCKAFFC KTRKRLGLDK LVEKYEDSLK VRYGGVMAES LECADVGRGE AAGMVAEDLR  1260
TSSLFECSCP GMEVESHGDK GDENEKSVEA VVPVDVQEME AVEVEAVEGV RVEGVVVEVQ  1320
SVESEVVQDV AIADDALVNG DVEPRGIEGF VAEDDASQEL MSKDEAIEKS VEDTGFEIAV  1380
VVASAADADV DKASSNASVE VTAFNEALRD ETVEDAAVEQ VVVSECLDAA AGILENENLA  1440
VEGSIVLEQV GTDGHPDEGR GVGGVAVETS NGVCEEGNGD AVGATSVVVI SKDVLLGSFV  1500
CLKEDTAIVD SACPADREPV ASTPAVDASG AEDPVCVRTD AVNVPNDASV EAVKVDAAED  1560
VFTGNKSTDL AAGCTIREGD PADVVKVAES GLESSKCVAA VGVDKAVFPV TKMSTQVADE  1620
PEAKASPKVD VKSEPGSPQV ATSVSTDSAS FTSAAAAVSH SGEPVFSTTS SMQGREKVGR  1680
VGGGETKSRR EPTSWTQEEK EKFADIIRNH GKDWTRLHEC LPSKSLTQIK TYFQNSKAKL  1740
GLLNAEGVNV PGGRVAGSRK RKVDEAENGS NNVSCLSSGN ELKGGGVSAS DMDGVCQNVK  1800
AAVGGVPSMN PSMGMGSGPS GLESMLYPFL GQRVEDQIAL QNFVRMYSAN GLAQNIAGGV  1860
NPFVQQYGFP MFPNAGHQRA SQLSLQQQLA ASLAQKSGQA KGLQQQELQG FGSVQQSGQA  1920
SVQQKVAHQL QSAQMVRNQQ LLASVMQHQA AAHHQQNQTS KSVPHPLQPQ VVVPQPGVAG  1980
QRQQHPQAQQ GGSQQEQGSP GHPIGNPSLG VGNPTQASTQ TKQLQQPQVS LHQQQTLQQL  2040
QHQQHQFLLQ QHDHDHVRAQ SHPQSHFHIQ QPQNSHASIV QPLIVQKPKG VVPLQPQVTK  2100
PPLGTVAHQR CMPYRHDQQQ LGPALSLLSG NGDSGLSNIR GEISNQHGEI GDHRSCISNG  2160
GASKGCDFSR ADFHQLSASV QRVKPSHAAI PHRPSPTPAA VSAQGRPGDV KLFGQSLLSQ  2220
PTSCAVSQSA ARELVSAADR GSLQQSPAST AASSSLTSMP VSAASATKSH GKESAFRGVS  2280
FMPDGLQGGR SSRGNQGSLE LWNNMSDVRS QAGPVSKSID GDSDIRSMQE CRMSREAQDV  2340
ESDPSTLKLT HKLQHLDQAR GVQEHSGSEG FSPVVHGVGK ARACANEHGV GVGFAVSCGE  2400
VSRTDPERRG ESIGIDLGCS ERSSIMASRS NRGQVESFAM QAAGLLANGP QVHRNLIDYL  2460
MAITELHQTR SLSSHSSVGQ PRLEDHQWES LTRHPTNGTA VDALKVNPTL GLGSPIAAPQ  2520
THLSGNDLFQ QCVRDSSMYF SQHYPSLAGH GVSSSAWNGG AGLVHPSEMQ RVLVNPPLSS  2580
FLPGVFSRAP VTEDHLGSTE TRDPERGGGG IC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-15877971194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-15877971194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109160.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769009.10.0predicted protein
TrEMBLA9SRK80.0A9SRK8_PHYPA; Predicted protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-34MYB family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]